PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK27938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family LFY
Protein Properties Length: 417aa    MW: 46252.9 Da    PI: 7.0814
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK27938.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY623.34.3e-19013871386
     FLO_LFY   1 mdpeafsaslfkwd.praaaaapparlleeaavseapleaaaaaaarklr..eleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslsei 96 
                 mdpe f++ lf+w+ +ra ++app+  ++   ++++++ ++aaa a  +r  +le lf ayG+r++t+akiaelGft+stLvdm+deel+++m+sls+i
  KFK27938.1   1 MDPEGFTSGLFRWNpTRALVQAPPQPQVPPPPQQSPATPHTAAAGAFGMRlgGLEGLFGAYGIRFYTAAKIAELGFTASTLVDMRDEELEEMMNSLSHI 99 
                 9*************55555566665555554444444344444444444444*********************************************** PP

     FLO_LFY  97 frldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkka 188
                 fr++llvGeryGikaavraerrr++e  ee++++rr+ll      + +++aldalsqeglseepv+++++++ ++g+g++++e+ +a+      +kk++
  KFK27938.1 100 FRWELLVGERYGIKAAVRAERRRVQEeeEEEASRRRHLLlsaggDSGTHHALDALSQEGLSEEPVHHHQDQTDAAGGGSSNWEVGQAK------SKKQQ 192
                 ************************98544445677777778755445566*****************999999989998899887665......23333 PP

     FLO_LFY 189 skkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfr 287
                    k+++k + ++++++d+ +e ++d++++g g  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+iak+rGekcPtkvtnqvfr
  KFK27938.1 193 ---KRRKKPMVTSVETDDDANEGDDDQEGNGVGVLGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFR 288
                 ...45555555556667777788889999999******************************************************************* PP

     FLO_LFY 288 yakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                 yakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  KFK27938.1 289 YAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 387
                 ***********************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.6E-1981386IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRALV QAPPQPQVPP PPQQSPATPH TAAAGAFGMR LGGLEGLFGA  60
YGIRFYTAAK IAELGFTAST LVDMRDEELE EMMNSLSHIF RWELLVGERY GIKAAVRAER  120
RRVQEEEEEE ASRRRHLLLS AGGDSGTHHA LDALSQEGLS EEPVHHHQDQ TDAAGGGSSN  180
WEVGQAKSKK QQKRRKKPMV TSVETDDDAN EGDDDQEGNG VGVLGMERQR EHPFIVTEPG  240
EVARGKKNGL DYLFHLYEQC REFLLQVQTI AKDRGEKCPT KVTNQVFRYA KKSGASYINK  300
PKMRHYVHCY ALHCLDEEAS NALRRAFKER GENVGSWRQA CYKPLVDIAC RHGWDIDAVF  360
NAHPRLSIWY VPTKLRQLCH LERNNAVATA AALVGGISCT GSSASGRGGC GGDELRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1372244171194PROTEIN LEAFY
2vy2_A1e-1372244171194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4369560.0JF436956.1 Arabis alpina LFY (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200993.10.0protein LEAFY
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLA0A087GDI60.0A0A087GDI6_ARAAL; Leafy protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)